Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

1,066 – 1,080 of 1,599,989 results

1,066

Invitrogen™ Adiponectin Monoclonal Antibody (19F1)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rabbit
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q15848, Q60994
Isotype	IgG
Concentration	1 mg/mL
Antigen	Adiponectin
Gene Symbols	ADIPOQ
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	30 kDa adipocyte complement-related protein; 30kDa; Acdc; Acrp30; Ad; adipo; adipocyte complement related protein; adipocyte complement related protein of 30 kDa; adipocyte complement-related 30 kDa protein; adipocyte complement-related protein of 30 kDa; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ; adiponectin; adiponectin, C1Q and collagen domain containing; Adipoq; Adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; ADIPQTL1; ADPIOQ; ADPN; Apm1; APM-1; APN; GBP28; Gelatin-binding protein; gelatin-binding protein 28
Gene	ADIPOQ
Product Type	Antibody
Gene ID (Entrez)	100009027, 11450, 9370
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Full length, recombinant, human adiponectin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	19F1

1,067

Invitrogen™ TSG101 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q61187, Q6IRE4, Q99816
Isotype	IgG
Concentration	1.42 mg/mL
Antigen	TSG101
Gene Symbols	Tsg101
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI255943; CC2; ESCRTI complex subunit TSG101; ESCRT-I complex subunit TSG101; Rw; TSG 101; TSG10; TSG101; Tumor supressor; tumor susceptibility 101; tumor susceptibility gene 10; tumor susceptibility gene 101; tumor susceptibility gene 101 protein; tumor susceptibility protein; VPS23
Gene	Tsg101
Product Type	Antibody
Gene ID (Entrez)	22088, 292925, 7251
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human TSG101. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

1,068

Invitrogen™ Mesothelin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Lyophilized
Gene Accession No.	Q61468
Isotype	IgG
Concentration	500 μg/mL
Antigen	Mesothelin
Gene Symbols	MSLN
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CAK1; CAK1 antigen; megakaryocyte potentiating factor; Megakaryocyte-potentiating factor; Mes; Mesothelin; Mesothelin, cleaved form; MPF; MSLN; Pre-pro-megakaryocyte-potentiating factor; SMR; SMRP; soluble MPF mesothelin related protein
Gene	MSLN
Product Type	Antibody
Gene ID (Entrez)	56047
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse Mesothelin recombinant protein (Position: K308-L576).
Classification	Polyclonal
Primary or Secondary	Primary

1,069

Invitrogen™ CD41 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08514, Q9QUM0
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399, 3674, 685269
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Classification	Polyclonal
Primary or Secondary	Primary

1,070

Invitrogen™ CD134 (OX40) Monoclonal Antibody (OX-86), Functional Grade, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Gene Accession No.	P47741
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD134 (OX40)
Gene Symbols	Tnfrsf4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ACT35; ACT35 antigen; ATC35 antigen; CD134; CD134 antigen; IMD16; Ly-70; lymphoid activation antigene ACT35; MRC OX40; Ox40; OX40 antigen; OX40 cell surface antigen; OX40 homologue; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 receptor; TNF receptor superfamily member 4; Tnfrsf4; tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor receptor superfamily member 4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor superfamily, member 4; Txgp1; Txgp1l
Gene	Tnfrsf4
Product Type	Antibody
Gene ID (Entrez)	22163
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	OX-86

1,071

CD3 Monoclonal Antibody (HIT3a), Functional Grade, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P04234, P07766, P09693, P20963
Concentration	1 mg/mL
Antigen	CD3
Gene Symbols	Cd247, Cd3d, CD3E, CD3g
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Product Type	Antibody
Gene ID (Entrez)	915, 916, 917, 919
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIT3a

1,072

Invitrogen™ CD11c Monoclonal Antibody (N418), Functional Grade, eBioscience™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Armenian Hamster
Conjugate	Functional Grade
Applications	Control,Flow Cytometry,Functional Assay
Form	Liquid
Gene Accession No.	Q9QXH4
Isotype	IgG
Concentration	1 mg/mL
Antigen	CD11c
Gene Symbols	Itgax
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Gene	Itgax
Product Type	Antibody
Gene ID (Entrez)	16411
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	N418

1,073

Invitrogen™ TCR alpha/beta Monoclonal Antibody (IP26), Super Bright™ 780, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Super Bright 780
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P01848, P04435, P0DSE1, P0DSE2
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	TCR alpha/beta
Gene Symbols	TRA, TRAC, TRB, TRBV7-9
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	FLJ22602; IMD7; LOC290071; MGC117436; MGC22624; MGC23964; MGC71411; RATTCB; RATTCBC1; RGD1359684; similar to RIKEN cDNA A430107P09 gene; T cell receptor beta locus; T3/TCR complex; TCB; TCBC1; t-cell antigen receptor; T-cell receptor alpha constant; T-cell receptor beta chain; T-cell receptor V alpha; tcr alpha; TCR alpha/ beta; TCR beta; TCRA; Tcrb; TRA; Tra29; TRAC; TRB; TRB@; TRCA
Gene	TRAC
Product Type	Antibody
Gene ID (Entrez)	28589, 28755, 6955, 6957
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IP26

1,074

CD86 (B7-2) Monoclonal Antibody (GL1), Super Bright™ 645, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 645
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P42082
Concentration	0.2 mg/mL
Antigen	CD86 (B7-2)
Gene Symbols	CD86
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	activation B7-2 antigen; B lymphocyte activation antigen B72; B7; B7.2; B70; B7-2; B-lymphocyte activation antigen B7-2; BU63; CD28 antigen ligand 2; Cd28l2; CD28LG2; CD86; CD86 antigen; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); CD86 antigen precursor; CD86 molecule; CLS1; CTLA-4 counter-receptor B7.2; early T cell costimulatory molecule-1; early T-cell costimulatory molecule 1; Early T-cell co-stimulatory molecule 1; ETC-1; FUN-1; LAB72; Ly58; Ly-58; MB7; MB7-2; membrane glycoprotein; MGC34413; T-lymphocyte activation antigen CD86; TS/A-2
Gene	CD86
Product Type	Antibody
Gene ID (Entrez)	12524
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	GL1

1,075

CD117 (c-Kit) Monoclonal Antibody (2B8), PE-Cyanine5, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse,Pig
Host Species	Rat
Conjugate	PE-Cyanine5
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P05532, Q2HWD6
Concentration	0.2 mg/mL
Antigen	CD117 (c-Kit)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	16590, 396810
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2B8

1,076

Invitrogen™ CD25 Monoclonal Antibody (PC61.5), Functional Grade, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay,Neutralization
Form	Liquid
Gene Accession No.	P01590
Isotype	IgG1 λ
Concentration	1 mg/mL
Antigen	CD25
Gene Symbols	IL2RA
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ADA; ADA1; Adenosine aminohydrolase; adenosine deaminase; CD25; CD25 antigen; cytokine receptor; IDDM10; IL 2 RA; IL 2 receptor; IL 2R; IL 2R subunit alpha; IL2 RA; IL2 RA antibody; IL2 receptor; il-2 receptor alpha; IL-2 Receptor alpha chain; IL-2 receptor alpha subunit; IL2 receptor subunit alpha; IL-2 receptor subunit alpha; IL2R; IL-2R alpha; IL-2R alpha chain; IL2R subunit alpha; IL-2R subunit alpha; Il2ra; IL-2RA; IL-2-RA; IL2-RA; Il2ra antibody; IL2RAC; IMD41; interleukin 2 receptor; interleukin 2 receptor alpha chain; interleukin 2 receptor subunit alpha; interleukin 2 receptor, alpha; interleukin 2 receptor, alpha chain; interleukin-2 receptor alpha; interleukin-2 receptor alpha chain; interleukin-2 receptor alpha subunit; interleukin-2 receptor beta chain; Interleukin2 receptor subunit alpha; interleukin-2 receptor subunit alpha; Ly-43; p55; p55 chain; sIL 2R; soluble IL 2 receptor; TAC antigen; TCGFR
Gene	IL2RA
Product Type	Antibody
Gene ID (Entrez)	16184
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	PC61.5

1,077

F4/80 Monoclonal Antibody (BM8), Super Bright™ 780, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 780
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	Q61549
Concentration	0.2 mg/mL
Antigen	F4/80
Regulatory Status	RUO
Product Type	Antibody
Gene ID (Entrez)	13733
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BM8

1,078

CD16/CD32 Monoclonal Antibody (93), APC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a λ
Gene Accession No.	P08101, P08508
Concentration	0.2 mg/mL
Antigen	CD16/CD32
Gene Symbols	Fcgr2b, Fcgr3
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AI528646; CD16; CD16a; CD16a antigen; CD16B; CD32; CD32 receptor 2; CD32B; CDw32; F630109E10Rik; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIb; Fc fragment of IgG receptor IIIa; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor (CD16a); fc gamma receptor IIB; Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor RII; Fc gamma RIIB; Fc gamma RIIIa; Fc receptor, IgG, low affinity IIb; Fc receptor, IgG, low affinity III; Fc[g]RII; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD16); fc-gamma RII; Fc-gamma RII-b; Fc-gamma RII-c; Fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; Fc-gamma-RII; FcgammaRIIB; fc-gamma-RIIB; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIIIA; Fcgr2; Fcgr2a; Fcgr2b; FCGR2C; Fcgr3; FCGR3A; FCGR3B; FcgRII; FCGRIII; FCR-10; Fcr-2; Fcr-3; fcRII; FcRII-b; FcRII-c; FCRIII; FCRIIIA; FGFR2B; IGFR3; IgG Fc receptor II beta; IgG Fc receptor III; IgG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; low affinity immunoglobulin gamma Fc region receptor II; low affinity immunoglobulin gamma Fc region receptor II-b; low affinity immunoglobulin gamma Fc region receptor III; Low affinity immunoglobulin gamma Fc region receptor III-A; Ly-17; Lym-1; Ly-m20; lymphocyte antigen 17; neutrophil-specific antigen NA; RP11-5K23.1
Gene	Fcgr3
Product Type	Antibody
Gene ID (Entrez)	14130, 14131
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	93

1,079

CD27 Monoclonal Antibody (LG.7F9), APC, eBioscience™, Invitrogen™

Armenian Hamster Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse,Rat
Host Species	Armenian Hamster
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG
Gene Accession No.	P26842, P41272
Concentration	0.2 mg/mL
Antigen	CD27
Gene Symbols	CD27
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD antigen 27; CD27; CD27 antigen; CD27 molecule; CD27L receptor; LPFS2; S152; S152. LPFS2; sCD27; soluble CD27; T cell activation antigen S152; T14; T-cell activation antigen CD27; TNFRSF7; TNFSF7; Tp55; Tumor necrosis factor receptor superfamily member 7; tumor necrosis factor receptor superfamily, member 7
Gene	CD27
Product Type	Antibody
Gene ID (Entrez)	21940, 500318, 939
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	LG.7F9

1,080

CD27 Monoclonal Antibody (O323), APC-eFluor™ 780, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	APC-eFluor 780
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	P26842
Concentration	5 μL/Test
Antigen	CD27
Gene Symbols	CD27
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	CD27
Product Type	Antibody
Gene ID (Entrez)	939
Classification	Monoclonal
Primary or Secondary	Primary
Clone	O323

Prev
1
...
70
71
72
73
...
106,666
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Adiponectin Monoclonal Antibody (19F1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TSG101 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Mesothelin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD134 (OX40) Monoclonal Antibody (OX-86), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD3 Monoclonal Antibody (HIT3a), Functional Grade, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11c Monoclonal Antibody (N418), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TCR alpha/beta Monoclonal Antibody (IP26), Super Bright™ 780, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD86 (B7-2) Monoclonal Antibody (GL1), Super Bright™ 645, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD117 (c-Kit) Monoclonal Antibody (2B8), PE-Cyanine5, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD25 Monoclonal Antibody (PC61.5), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD16/CD32 Monoclonal Antibody (93), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD27 Monoclonal Antibody (LG.7F9), APC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD27 Monoclonal Antibody (O323), APC-eFluor™ 780, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Adiponectin Monoclonal Antibody (19F1)

Invitrogen™ TSG101 Polyclonal Antibody

Invitrogen™ Mesothelin Polyclonal Antibody

Invitrogen™ CD41 Polyclonal Antibody

Invitrogen™ CD134 (OX40) Monoclonal Antibody (OX-86), Functional Grade, eBioscience™

CD3 Monoclonal Antibody (HIT3a), Functional Grade, eBioscience™, Invitrogen™

Invitrogen™ CD11c Monoclonal Antibody (N418), Functional Grade, eBioscience™

Invitrogen™ TCR alpha/beta Monoclonal Antibody (IP26), Super Bright™ 780, eBioscience™

CD86 (B7-2) Monoclonal Antibody (GL1), Super Bright™ 645, eBioscience™, Invitrogen™

CD117 (c-Kit) Monoclonal Antibody (2B8), PE-Cyanine5, eBioscience™, Invitrogen™

Invitrogen™ CD25 Monoclonal Antibody (PC61.5), Functional Grade, eBioscience™

CD16/CD32 Monoclonal Antibody (93), APC, eBioscience™, Invitrogen™

CD27 Monoclonal Antibody (LG.7F9), APC, eBioscience™, Invitrogen™

CD27 Monoclonal Antibody (O323), APC-eFluor™ 780, eBioscience™, Invitrogen™